-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MAGED1/NRAGE was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 635-834 of human MAGED1/NRAGE (NP_001005333.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against MAGED1/NRAGE was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 635-834 of human MAGED1/NRAGE (NP_001005333.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-01718A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MAGED1/NRAGE |
| Target Synonyms | NRAGE; DLXIN-1; MAGED1/NRAGE | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 635-834 of human MAGED1/NRAGE (NP_001005333.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EAVLWEALRKMGLRPGVRHPLLGDLRKLLTYEFVKQKYLDYRRVPNSNPPEYEFLWGLRSYHETSKMKVLRFIAEVQKRDPRDWTAQFMEAADEALDALDAAAAEAEARAEARTRMGIGDEAVSGPWSWDDIEFELLTWDEEGDFGDPWSRIPFTFWARYHQNARSRFPQTFAGPIIGPGGTASANFAANFGAIGFFWVE | Uniprot ID | Q9Y5V3 |
Uniprot Id
Q9Y5V3
Target Species
Human
Target Name
MAGED1
Target Full Name
Melanoma-associated antigen D1
Target Function
Involved in the apoptotic response after nerve growth factor (NGF) binding in neuronal cells. Inhibits cell cycle progression, and facilitates NGFR-mediated apoptosis. May act as a regulator of the function of DLX family members. May enhance ubiquitin ligase activity of RING-type zinc finger-containing E3 ubiquitin-protein ligases. Proposed to act through recruitment and/or stabilization of the Ubl-conjugating enzyme (E2) at the E3:substrate complex. Plays a role in the circadian rhythm regulation. May act as RORA co-regulator, modulating the expression of core clock genes such as ARNTL/BMAL1 and NFIL3, induced, or NR1D1, repressed.
Target Subcellular Location
Cytoplasm. Cell membrane; Peripheral membrane protein. Nucleus.
Target Tissue Specificity
Expressed in bone marrow stromal cells from both multiple myeloma patients and healthy donors. Seems to be ubiquitously expressed.
Target Synonyms
DLXIN 1; MAGD1_HUMAN; MAGE D1 antigen; MAGE tumor antigen CCF; MAGE-D1 antigen; Maged1; Melanoma antigen family D 1 ; Melanoma associated antigen D1; Melanoma-associated antigen D1; Neurotrophin receptor interacting MAGE homolog; Neurotrophin receptor-interacting MAGE homolog; NRAGE; PP2250
Target Background
This gene is a member of the melanoma antigen gene (MAGE) family. Most of the genes of this family encode tumor specific antigens that are not expressed in normal adult tissues except testis. Although the protein encoded by this gene shares strong homology with members of the MAGE family, it is expressed in almost all normal adult tissues. This gene has been demonstrated to be involved in the p75 neurotrophin receptor mediated programmed cell death pathway. Three transcript variants encoding two different isoforms have been found for this gene.
Notification