Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MAGI3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human MAGI3 (NP_001136254.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MAGI3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human MAGI3 (NP_001136254.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00869A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MAGI3 |
| Target Synonyms | MAGI-3; dJ730K3.2; MAGI3 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human MAGI3 (NP_001136254.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSKTLKKKKHWLSKVQECAVSWAGPPGDFGAEIRGGAERGEFPYLGRLREEPGGGTCCVVSGKAPSPGDVLLEVNGTPVSGLTNRDTLAVIRHFREPIRLKTVKP | Uniprot ID | Q5TCQ9 |
Uniprot Id
Q5TCQ9
Target Species
Human
Target Name
MAGI3
Target Full Name
Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3
Target Function
Acts as a scaffolding protein at cell-cell junctions, thereby regulating various cellular and signaling processes. Cooperates with PTEN to modulate the kinase activity of AKT1. Its interaction with PTPRB and tyrosine phosphorylated proteins suggests that it may link receptor tyrosine phosphatase with its substrates at the plasma membrane. In polarized epithelial cells, involved in efficient trafficking of TGFA to the cell surface. Regulates the ability of LPAR2 to activate ERK and RhoA pathways. Regulates the JNK signaling cascade via its interaction with FZD4 and VANGL2.
Target Subcellular Location
Cell membrane; Peripheral membrane protein. Cell junction, tight junction. Nucleus.
Target Protein Families
MAGUK family
Target Tissue Specificity
Widely expressed.
Target Synonyms
dJ730K3.2; MAGI-3; magi3; MAGI3_HUMAN; Membrane Associated Guanylate kinase Related 3; Membrane associated guanylate kinase, WW and PDZ domain containing 3; Membrane associated guanylate kinase, WW and PDZ domain containing protein 3; Membrane-associated guanylate kinase; Membrane-associated guanylate kinase inverted 3; RP4-730K3.1; SLIPR; WW and PDZ domain-containing protein 3
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
