-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MAK was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 370-435 of human MAK (NP_005897.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against MAK was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 370-435 of human MAK (NP_005897.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-06904A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MAK |
| Target Synonyms | RP62; MAK | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung, Rat lung | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 370-435 of human MAK (NP_005897.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKD | Uniprot ID | P20794 |
Uniprot Id
P20794
Target Species
Human
Target Name
MAK
Target Full Name
Serine/threonine-protein kinase MAK
Target Function
Essential for the regulation of ciliary length and required for the long-term survival of photoreceptors. Phosphorylates FZR1 in a cell cycle-dependent manner. Plays a role in the transcriptional coactivation of AR. Could play an important function in spermatogenesis. May play a role in chromosomal stability in prostate cancer cells.
Target Involvement
Retinitis pigmentosa 62 (RP62)
Target Subcellular Location
Nucleus. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton, spindle. Midbody. Cell projection, cilium, photoreceptor outer segment. Photoreceptor inner segment.
Target Protein Families
Protein kinase superfamily, CMGC Ser/Thr protein kinase family, CDC2/CDKX subfamily
Target Tissue Specificity
Expressed in prostate cancer cell lines at generally higher levels than in normal prostate epithelial cell lines. Isoform 1 is expressed in kidney, testis, lung, trachea, and retina. Isoform 2 is retina-specific where it is expressed in rod and cone photo
Target Synonyms
MAKSerine/threonine-protein kinase MAK; EC 2.7.11.1; Male germ cell-associated kinase
Target Background
The product of this gene is a serine/threonine protein kinase related to kinases involved in cell cycle regulation. Studies of the mouse and rat homologs have localized the kinase to the chromosomes during meiosis in spermatogenesis, specifically to the synaptonemal complex that exists while homologous chromosomes are paired. Mutations in this gene have been associated with ciliary defects resulting in retinitis pigmentosa 62. Alternative splicing results in multiple transcript variants.
Notification