-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MAP3K4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human MAP3K4 (Q9Y6R4) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against MAP3K4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human MAP3K4 (Q9Y6R4) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14509A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MAP3K4 |
| Target Synonyms | MTK1; MEKK4; MEKK 4; MAPKKK4; PRO0412; MAP3K4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat testis | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human MAP3K4 (Q9Y6R4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QRNNVGRPASRSNLKEKMNAPNQPPHKDTGKTVENVEEYSYKQEKKIRAALRTTERDRKKNVQCSFMLDSVGGSLPKKSIPDVDLNKPYLSLGCSNAKLPV | Uniprot ID | Q9Y6R4 |
Uniprot Id
Q9Y6R4
Target Species
Human
Target Name
MAP3K4
Target Full Name
Mitogen-activated protein kinase kinase kinase 4
Target Function
Component of a protein kinase signal transduction cascade. Activates the CSBP2, P38 and JNK MAPK pathways, but not the ERK pathway. Specifically phosphorylates and activates MAP2K4 and MAP2K6.
Target Subcellular Location
Cytoplasm, perinuclear region.
Target Protein Families
Protein kinase superfamily, STE Ser/Thr protein kinase family, MAP kinase kinase kinase subfamily
Target Tissue Specificity
Expressed at high levels in heart, placenta, skeletal muscle and pancreas, and at lower levels in other tissues.
Target Synonyms
dJ473J16.1 (mitogen-activated protein kinase kinase kinase 4); FLJ42439; KIAA0213; M3K4_HUMAN; MAP three kinase 1; MAP/ERK kinase kinase 4; MAP3K4; MAPK/ERK kinase kinase 4; MAPKKK4; MEK kinase 4; MEKK 4; MEKK4; Mitogen-activated protein kinase kinase kinase 4; MTK1; predicted protein of HQ0412; PRO0412; RP3-473J16.4; SSK2/SSK22 MAP kinase kinase kinase; yeast; homolog of
Target Background
The central core of each mitogen-activated protein kinase (MAPK) pathway is a conserved cascade of 3 protein kinases: an activated MAPK kinase kinase (MAPKKK) phosphorylates and activates a specific MAPK kinase (MAPKK), which then activates a specific MAPK. While the ERK MAPKs are activated by mitogenic stimulation, the CSBP2 and JNK MAPKs are activated by environmental stresses such as osmotic shock, UV irradiation, wound stress, and inflammatory factors. This gene encodes a MAPKKK, the MEKK4 protein, also called MTK1. This protein contains a protein kinase catalytic domain at the C terminus. The N-terminal nonkinase domain may contain a regulatory domain. Expression of MEKK4 in mammalian cells activated the CSBP2 and JNK MAPK pathways, but not the ERK pathway. In vitro kinase studies indicated that recombinant MEKK4 can specifically phosphorylate and activate PRKMK6 and SERK1, MAPKKs that activate CSBP2 and JNK, respectively but cannot phosphorylate PRKMK1, an MAPKK that activates ERKs. MEKK4 is a major mediator of environmental stresses that activate the CSBP2 MAPK pathway, and a minor mediator of the JNK pathway. Several alternatively spliced transcripts encoding distinct isoforms have been described.
Notification