Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MARVELD1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-50 of human MARVELD1 (NP_113672.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MARVELD1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-50 of human MARVELD1 (NP_113672.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07094A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MARVELD1 |
| Target Synonyms | GB14; MARVD1; MRVLDC1; bA548K23.8; MARVELD1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat heart, HT-29 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-50 of human MARVELD1 (NP_113672.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MLPPPPRQPPPQARAARGAVRLQRPFLRSPLGVLRLLQLLAGAAFWITIA | Uniprot ID | Q9BSK0 |
Uniprot Id
Q9BSK0
Target Species
Human
Target Name
MARVELD1
Target Full Name
MARVEL domain-containing protein 1
Target Function
Microtubule-associated protein that exhibits cell cycle-dependent localization and can inhibit cell proliferation and migration.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasm, cytoskeleton. Nucleus.
Target Tissue Specificity
Widely expressed in normal tissues. Down-regulated in multiple primary tumors.
Target Synonyms
MARVELD1; MRVLDC1; MARVEL domain-containing protein 1
Target Background
Predicted to be a structural constituent of myelin sheath. Predicted to be involved in myelination. Predicted to be located in several cellular components, including cytoskeleton; nucleus; and plasma membrane. Predicted to be integral component of membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
