-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MED24 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human MED24 (NP_055630.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MED24 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human MED24 (NP_055630.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01801A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MED24 |
| Target Synonyms | MED5; CRSP4; ARC100; THRAP4; CRSP100; DRIP100; TRAP100; MED24 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, BT-474, Jurkat, Mouse brain, Mouse testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human MED24 (NP_055630.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MKVVNLKQAILQAWKERWSDYQWAINMKKFFPKGATWDILNLADALLEQAMIGPSPNPLILSYLKYAISSQMVSYSSVLTAISKFDDFSRDLCVQALLDIMDMFCDRLSCHGKAEECIGLCRALLSALHWLLRCTAASAERLREGLEAGTPAAGEKQLAM | Uniprot ID | O75448 |
Uniprot Id
O75448
Target Species
Human
Target Name
MED24
Target Full Name
Mediator of RNA polymerase II transcription subunit 24
Target Function
Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
Target Subcellular Location
Nucleus.
Target Protein Families
Mediator complex subunit 24 family
Target Tissue Specificity
Ubiquitous. Abundant in skeletal muscle, heart and placenta.
Target Synonyms
CRSP complex subunit 4; Activator recruited cofactor 100 kDa component; Activator-recruited cofactor 100 kDa component; ARC100; Cofactor required for Sp1 transcriptional activation subunit 4; CRSP complex subunit 4; CRSP100; CRSP4; DRIP100; hTRAP100; KIAA0130; MED 24; MED24; MED24_HUMAN; Mediator complex subunit 24; Mediator of RNA polymerase II transcription subunit 24; Mediator of RNA polymerase II transcription subunit 24 homolog; MGC8748; OTTHUMP00000164458; OTTHUMP00000164460; THRAP4; Thyroid hormone receptor associated protein 4; Thyroid hormone receptor associated protein complex 100 kDa component; Thyroid hormone receptor-associated protein 4; Thyroid hormone receptor-associated protein complex 100 kDa component; Trap100; Trapp100; Vitamin D3 receptor interacting protein complex component DRIP100; Vitamin D3 receptor-interacting protein complex 100 kDa component
Target Background
This gene encodes a component of the mediator complex (also known as TRAP, SMCC, DRIP, or ARC), a transcriptional coactivator complex thought to be required for the expression of almost all genes. The mediator complex is recruited by transcriptional activators or nuclear receptors to induce gene expression, possibly by interacting with RNA polymerase II and promoting the formation of a transcriptional pre-initiation complex. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification