-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MRPS12 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 20-138 of human CYB5R3(NM_000398.7) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MRPS12 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 20-138 of human CYB5R3(NM_000398.7) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08302A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MRPS12 |
| Target Synonyms | MRPS12; MPR-S12; MT-RPS12; RPMS12; RPS12; RPSM12; mitochondrial ribosomal protein S12 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 20-138 of human CYB5R3(NM_000398.7). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LVPRLWATCSMATLNQMHRLGPPKRPPRKLGPTEGRPQLKGVVLCTFTRKPKKPNSANRKCCRVRLSTGREAVCFIPGEGHTLQEHQIVLVEGGRTQDLPGVKLTVVRGKYDCGHVQKK | Uniprot ID | O15235 |
Uniprot Id
O15235
Target Species
Human
Target Name
MRPS12
Target Full Name
Small ribosomal subunit protein uS12m
Target Subcellular Location
Mitochondrion.
Target Protein Families
Universal ribosomal protein uS12 family
Target Synonyms
28S ribosomal protein S12; 28S ribosomal protein S12 mitochondrial; mitochondrial; Mitochondrial ribosomal protein S12; MRP-S12; MRPS12; MT-RPS12; RPMS12; RPS12; RPSM12; RT12_HUMAN; S12mt
Target Background
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S12P family. The encoded protein is a key component of the ribosomal small subunit and controls the decoding fidelity and susceptibility to aminoglycoside antibiotics. The gene for mitochondrial seryl-tRNA synthetase is located upstream and adjacent to this gene, and both genes are possible candidates for the autosomal dominant deafness gene (DFNA4). Splice variants that differ in the 5' UTR have been found for this gene; all three variants encode the same protein.
Notification