Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MRPS6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-125 of human MRPS6 (NP_115865.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MRPS6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-125 of human MRPS6 (NP_115865.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00879A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MRPS6 |
| Target Synonyms | S6mt; RPMS6; MRP-S6; C21orf101; MRPS6 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, 22Rv1, B cells, Jurkat, MCF7 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-125 of human MRPS6 (NP_115865.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPRYELALILKAMQRPETAATLKRTIEALMDRGAIVRDLENLGERALPYRISAHSQQHNRGGYFLVDFYAPTAAVESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYSTKKRKK | Uniprot ID | P82932 |
Uniprot Id
P82932
Target Species
Human
Target Name
MRPS6
Target Full Name
Small ribosomal subunit protein bS6m
Target Subcellular Location
Mitochondrion.
Target Protein Families
Bacterial ribosomal protein bS6 family
Target Research Area
others
Target Synonyms
MRPS6; C21orf101; RPMS628S ribosomal protein S6; mitochondrial; MRP-S6; S6mt; Mitochondrial small ribosomal subunit protein bS6m
Target Background
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S6P family. Pseudogenes corresponding to this gene are found on chromosomes 1p and 12q.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
