Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MS4A12 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human MS4A12 (NP_060186.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MS4A12 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human MS4A12 (NP_060186.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01584A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MS4A12 |
| Target Synonyms | Ms4a10; MS4A12 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, BT-474, NCI-H460 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human MS4A12 (NP_060186.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MMSSKPTSHAEVNETIPNPYPPSSFMAPGFQQPLGSINLENQAQGAQRAQPYGITSPGIFASSQPGQGNIQMINPSVGTAVMNFKEEAKA | Uniprot ID | Q9NXJ0 |
Uniprot Id
Q9NXJ0
Target Species
Human
Target Name
MS4A12
Target Full Name
Membrane-spanning 4-domains subfamily A member 12
Target Function
May be involved in signal transduction as a component of a multimeric receptor complex.
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
MS4A family
Target Synonyms
MS4A12; Membrane-spanning 4-domains subfamily A member 12
Target Background
The protein encoded by this gene is a cell surface protein found primarily in the apical membrane of colonocytes. Silencing of this gene in colon cancer cells inhibits the proliferation, cell motility, and chemotactic invasion of cells. This gene is part of a cluster of similar genes found on chromosome 11. Two transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
