-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MUC2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 5000-5100 of human MUC2 (Q02817) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against MUC2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 5000-5100 of human MUC2 (Q02817) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-17014A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MUC2 |
| Target Synonyms | MLP; SMUC; MUC-2; MUC2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse stomach, Rat large intestine, SGC-7901 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 5000-5100 of human MUC2 (Q02817). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PDNQHVILKPGDFKSDPKNNCTFFSCVKIHNQLISSVSNITCPNFDASICIPGSITFMPNGCCKTCTPRNETRVPCSTVPVTTEVSYAGCTKTVLMNHCSG | Uniprot ID | Q02817 |
Uniprot Id
Q02817
Target Species
Human
Target Name
MUC2
Target Full Name
Mucin-2
Target Function
Coats the epithelia of the intestines, airways, and other mucus membrane-containing organs. Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. Major constituent of both the inner and outer mucus layers of the colon and may play a role in excluding bacteria from the inner mucus layer.
Target Subcellular Location
Secreted.
Target Tissue Specificity
Colon, small intestine, colonic tumors, bronchus, cervix and gall bladder.
Target Research Area
Signal Transduction
Target Synonyms
Intestinal mucin 2; Intestinal mucin-2; MLP; MUC 2; MUC-2; Muc2; MUC2_HUMAN; Mucin 2; Mucin 2 intestinal; Mucin 2 intestinal/tracheal; Mucin 2 oligomeric mucus/gel forming; Mucin 2 precursor ; Mucin 2 tracheal ; Mucin like protein; Mucin-2; Mucin2; SMUC
Target Background
This gene encodes a member of the mucin protein family. Mucins are high molecular weight glycoproteins produced by many epithelial tissues. The protein encoded by this gene is secreted and forms an insoluble mucous barrier that protects the gut lumen. The protein polymerizes into a gel of which 80% is composed of oligosaccharide side chains by weight. The protein features a central domain containing tandem repeats rich in threonine and proline that varies between 50 and 115 copies in different individuals. Downregulation of this gene has been observed in patients with Crohn disease and ulcerative colitis.
Notification