Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MYL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human MYL1 (NP_524146.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MYL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human MYL1 (NP_524146.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09015A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MYL1 |
| Target Synonyms | MLC1; MLC-1; MLC1F; MLC3F; CMYP14; MLC1/3; MYOFTA; MYL1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat heart, HL-60 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human MYL1 (NP_524146.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSFSADQIAEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFLPMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCINYEAFVKHIMSI | Uniprot ID | P05976 |
Uniprot Id
P05976
Target Species
Human
Target Name
MYL1
Target Full Name
Myosin light chain 1/3, skeletal muscle isoform
Target Function
Non-regulatory myosin light chain required for proper formation and/or maintenance of myofibers, and thus appropriate muscle function.
Target Research Area
Signal Transduction
Target Synonyms
A1 catalytic; Alkali myosin light chain 1; MLC1/MLC3; MLC1F; MLC1F/MLC3F; MLC3F; Myl1; MYL1_HUMAN; Myosin light chain 1 skeletal muscle isoform; Myosin light chain 1/3; Myosin light chain 1/3, skeletal muscle isoform; Myosin light chain A1/A2; Myosin light chain alkali 1/2; skeletal muscle isoform
Target Background
Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in fast skeletal muscle. Two transcript variants have been identified for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
