-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against N-Cadherin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human N Cadherin (P19022) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against N-Cadherin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human N Cadherin (P19022) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-17281A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | N-Cadherin |
| Target Synonyms | CDHN; NCAD; ACOGS; ADHD8; CD325; ARVD14; CDw325; in | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, HeLa, NIH/3T3, 293T | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human N Cadherin (P19022). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AKFLIYAQDKETQEKWQVAVKLSLKPTLTEESVKESAEVEEIVFPRQFSKHSGHLQRQKRDWVIPPINLPENSRGPFPQELVRIRSDRDKNLSLRYSVTGP | Uniprot ID | P19022 |
Uniprot Id
P19022
Target Species
Human
Target Name
CDH2
Target Full Name
Cadherin-2
Target Function
Calcium-dependent cell adhesion protein; preferentially mediates homotypic cell-cell adhesion by dimerization with a CDH2 chain from another cell. Cadherins may thus contribute to the sorting of heterogeneous cell types. Acts as a regulator of neural stem cells quiescence by mediating anchorage of neural stem cells to ependymocytes in the adult subependymal zone: upon cleavage by MMP24, CDH2-mediated anchorage is affected, leading to modulate neural stem cell quiescence. Plays a role in cell-to-cell junction formation between pancreatic beta cells and neural crest stem (NCS) cells, promoting the formation of processes by NCS cells. CDH2 may be involved in neuronal recognition mechanism. In hippocampal neurons, may regulate dendritic spine density.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cell membrane, sarcolemma. Cell junction. Cell surface.
Target Synonyms
CDH2; CDHN; NCAD; Cadherin-2; CDw325; Neural cadherin; N-cadherin; CD antigen CD325
Target Background
This gene encodes a classical cadherin and member of the cadherin superfamily. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein is proteolytically processed to generate a calcium-dependent cell adhesion molecule and glycoprotein. This protein plays a role in the establishment of left-right asymmetry, development of the nervous system and the formation of cartilage and bone.
Notification