-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NAIP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 750-850 of human NAIP (NP_075043.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NAIP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 750-850 of human NAIP (NP_075043.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04090A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NAIP |
| Target Synonyms | BIRC1; NLRB1; psiNAIP; NAIP | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat lung, Rat spleen | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 750-850 of human NAIP (NP_075043.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LLRSIHFPIRGNKTSPRAHFSVLETCFDKSQVPTIDQDYASAFEPMNEWERNLAEKEDNVKSYMDMQRRASPDLSTGYWKLSPKQYKIPCLEVDVNDIDVV | Uniprot ID | Q13075 |
Uniprot Id
Q13075
Target Species
Human
Target Name
NAIP
Target Full Name
Baculoviral IAP repeat-containing protein 1
Target Function
Anti-apoptotic protein which acts by inhibiting the activities of CASP3, CASP7 and CASP9. Can inhibit the autocleavage of pro-CASP9 and cleavage of pro-CASP3 by CASP9. Capable of inhibiting CASP9 autoproteolysis at 'Asp-315' and decreasing the rate of auto proteolysis at 'Asp-330'. Acts as a mediator of neuronal survival in pathological conditions. Prevents motor-neuron apoptosis induced by a variety of signals. Possible role in the prevention of spinal muscular atrophy that seems to be caused by inappropriate persistence of motor-neuron apoptosis: mutated or deleted forms of NAIP have been found in individuals with severe spinal muscular atrophy.; Acts as a sensor component of the NLRC4 inflammasome that specifically recognizes and binds needle protein CprI from pathogenic bacteria C.violaceum. Association of pathogenic bacteria proteins drives in turn drive assembly and activation of the NLRC4 inflammasome, promoting caspase-1 activation, cytokine production and macrophage pyroptosis. The NLRC4 inflammasome is activated as part of the innate immune response to a range of intracellular bacteria such as C.violaceum and L.pneumophila.
Target Tissue Specificity
Expressed in motor neurons, but not in sensory neurons. Found in liver and placenta, and to a lesser extent in spinal cord.
Target Research Area
Cancer
Target Synonyms
Baculoviral IAP repeat containing 1; Baculoviral IAP repeat-containing protein 1; BIRC 1; BIRC1; BIRC1_HUMAN; Birc1a; FLJ42520; NAIP; Naip1; Neuronal apoptosis inhibitory protein; NLR family apoptosis inhibitory protein; NLR family BIR domain containing 1; NLRB 1; NLRB1; Nucleotide binding oligomerization domain leucine rich repeat and BIR domain containing 1; Psi neuronal apoptosis inhibitory protein; psiNAIP; Similar to occludin
Target Background
This gene is part of a 500 kb inverted duplication on chromosome 5q13. This duplicated region contains at least four genes and repetitive elements which make it prone to rearrangements and deletions. The repetitiveness and complexity of the sequence have also caused difficulty in determining the organization of this genomic region. This copy of the gene is full length; additional copies with truncations and internal deletions are also present in this region of chromosome 5q13. It is thought that this gene is a modifier of spinal muscular atrophy caused by mutations in a neighboring gene, SMN1. The protein encoded by this gene contains regions of homology to two baculovirus inhibitor of apoptosis proteins, and it is able to suppress apoptosis induced by various signals. Alternative splicing and the use of alternative promoters results in multiple transcript variants.
Notification