Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NAP1L2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human NAP1L2 (NP_068798.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NAP1L2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human NAP1L2 (NP_068798.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02161A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NAP1L2 |
| Target Synonyms | BPX; NAP1L2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, Jurkat, Rat kidney, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human NAP1L2 (NP_068798.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAESENRKELSESSQEEAGNQIMVEGLGEHLERGEDAAAGLGDDGKCGEEAAAGLGEEGENGEDTAAGSGEDGKKGGDTDEDSEADRPKGLIGYVLDTDF | Uniprot ID | Q9ULW6 |
Uniprot Id
Q9ULW6
Target Species
Human
Target Name
NAP1L2
Target Full Name
Nucleosome assembly protein 1-like 2
Target Function
Acidic protein which may be involved in interactions with other proteins or DNA.
Target Subcellular Location
Nucleus.
Target Protein Families
Nucleosome assembly protein (NAP) family
Target Synonyms
NAP1L2; BPX; Nucleosome assembly protein 1-like 2; Brain-specific protein; X-linked
Target Background
The protein encoded by this intronless gene is a member of the nucleosome assembly protein (NAP) family. The encoded protein represents a class of tissue-specific factors that interact with chromatin to regulate neuronal cell proliferation.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
