Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NCOA7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human NCOA7 (NP_861447.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NCOA7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human NCOA7 (NP_861447.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06030A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NCOA7 |
| Target Synonyms | ESNA1; TLDC4; ERAP140; NCOA7-AS; Nbla00052; Nbla10993; dJ187J11.3; NCOA7 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human NCOA7 (NP_861447.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDTKEEKKERKQSYFARLKKKKQAKQNAETASAVATRTHTGKEDNNTVVLEPDKCNIAVEEEYMTDEKKKRKSNQLKEIRRTELKRYYSI | Uniprot ID | Q8NI08 |
Uniprot Id
Q8NI08
Target Species
Human
Target Name
NCOA7
Target Full Name
Nuclear receptor coactivator 7
Target Function
Enhances the transcriptional activities of several nuclear receptors. Involved in the coactivation of different nuclear receptors, such as ESR1, THRB, PPARG and RARA.
Target Subcellular Location
Nucleus.
Target Protein Families
OXR1 family
Target Tissue Specificity
Highly expressed in brain. Weakly expressed in mammary gland, ovary, uterus, prostate, stomach, bladder, spinal cord and pancreas. Expressed in cancer cell line.
Target Synonyms
NCOA7; ERAP140; ESNA1; Nbla00052; Nbla10993; Nuclear receptor coactivator 7; 140 kDa estrogen receptor-associated protein; Estrogen nuclear receptor coactivator 1
Target Background
Enables nuclear receptor binding activity and nuclear receptor coactivator activity. Involved in positive regulation of transcription by RNA polymerase II. Predicted to be active in nucleus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
