-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NDST1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 40-170 of human NDST1 (NP_001534.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NDST1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 40-170 of human NDST1 (NP_001534.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06897A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NDST1 |
| Target Synonyms | HSST; NST1; MRT46; NDST1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 40-170 of human NDST1 (NP_001534.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GWKRGLEPSADAPEPDCGDPPPVAPSRLLPLKPVQAATPSRTDPLVLVFVESLYSQLGQEVVAILESSRFKYRTEIAPGKGDMPTLTDKGRGRFALIIYENILKYVNLDAWNRELLDKYCVAYGVGIIGFF | Uniprot ID | P52848 |
Uniprot Id
P52848
Target Species
Human
Target Name
NDST1
Target Full Name
Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1
Target Function
Essential bifunctional enzyme that catalyzes both the N-deacetylation and the N-sulfation of glucosamine (GlcNAc) of the glycosaminoglycan in heparan sulfate. Modifies the GlcNAc-GlcA disaccharide repeating sugar backbone to make N-sulfated heparosan, a prerequisite substrate for later modifications in heparin biosynthesis. Plays a role in determining the extent and pattern of sulfation of heparan sulfate. Compared to other NDST enzymes, its presence is absolutely required. Participates in biosynthesis of heparan sulfate that can ultimately serve as L-selectin ligands, thereby playing a role in inflammatory response. Required for the exosomal release of SDCBP, CD63 and syndecan.
Target Involvement
Mental retardation, autosomal recessive 46 (MRT46)
Target Subcellular Location
Golgi apparatus membrane; Single-pass type II membrane protein.
Target Protein Families
Sulfotransferase 1 family, NDST subfamily
Target Tissue Specificity
Widely expressed. Expression is most abundant in heart, liver and pancreas.
Target Synonyms
NDST1; HSST; HSST1; Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1; EC 2.8.2.8; Glucosaminyl N-deacetylase/N-sulfotransferase 1; NDST-1; N-heparan sulfate sulfotransferase 1; N-HSST 1; [Heparan sulfate]-glucosamine N-sulfotransferase 1; HSNST 1) [Includes: Heparan sulfate N-deacetylase 1; EC 3.-.-.-); Heparan sulfate N-sulfotransferase 1; EC 2.8.2.-)]
Target Background
This gene encodes a member of the heparan sulfate/heparin GlcNAc N-deacetylase/ N-sulfotransferase family. The encoded enzyme is a type II transmembrane protein that resides in the Golgi apparatus. The encoded protein catalyzes the transfer of sulfate from 3'-phosphoadenosine 5'-phosphosulfate to nitrogen of glucosamine in heparan sulfate. Alternative splicing results in multiple transcript variants.
Notification