-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NDUFS4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human NDUFS4 (O43181) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against NDUFS4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human NDUFS4 (O43181) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-14208A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NDUFS4 |
| Target Synonyms | AQDQ; CI-18; MC1DN1; CI-AQDQ; CI-18 kDa; NDUFS4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat brain, Rat heart, HepG2, Mouse liver, Rat kidney | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human NDUFS4 (O43181). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAAVSMSVVLRQTLWRRRAVAVAALSVSRVPTRSLRTSTWRLAQDQTQDTQLITVDEKLDITTLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKME | Uniprot ID | O43181 |
Uniprot Id
O43181
Target Species
Human
Target Name
NDUFS4
Target Full Name
NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial
Target Function
Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Target Involvement
Mitochondrial complex I deficiency (MT-C1D); Leigh syndrome (LS)
Target Subcellular Location
Mitochondrion inner membrane; Peripheral membrane protein; Matrix side.
Target Protein Families
Complex I NDUFS4 subunit family
Target Synonyms
AQDQ; CI 18; CI 18 kDa; CI AQDQ; CI-18 kDa; CI-AQDQ; Complex I 18 kDa; Complex I AQDQ; Complex I-18 kDa; Complex I-AQDQ; mitochondrial; mitochondrial respiratory chain complex I (18 KD subunit); NADH coenzyme Q reductase; NADH dehydrogenase (ubiquinone) Fe S protein 4 18kDa; NADH dehydrogenase [ubiquinone] iron-sulfur protein 4; NADH dehydrogenase; NADH ubiquinone oxidoreductase 18 kDa subunit; NADH-ubiquinone oxidoreductase 18 kDa subunit; NDUFS4; NDUS4_HUMAN
Target Background
This gene encodes an nuclear-encoded accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (complex I, or NADH:ubiquinone oxidoreductase). Complex I removes electrons from NADH and passes them to the electron acceptor ubiquinone. Mutations in this gene can cause mitochondrial complex I deficiencies such as Leigh syndrome. Alternative splicing results in multiple transcript variants.
Notification