-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NDUFS7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 39-213 of human NDUFS7 (NP_077718.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NDUFS7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 39-213 of human NDUFS7 (NP_077718.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08678A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NDUFS7 |
| Target Synonyms | PSST; CI-20; MY017; MC1DN3; CI-20KD; NDUFS7 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse skeletal muscle | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 39-213 of human NDUFS7 (NP_077718.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PSSTQPALPKARAVAPKPSSRGEYVVAKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYIPGCPPTAEALLYGILQLQRKIKRERRLQIWYRR | Uniprot ID | O75251 |
Uniprot Id
O75251
Target Species
Human
Target Name
NDUFS7
Target Full Name
NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial
Target Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. Essential for the catalytic activity of complex I.
Target Involvement
Leigh syndrome (LS); Mitochondrial complex I deficiency (MT-C1D)
Target Subcellular Location
Mitochondrion inner membrane; Peripheral membrane protein; Matrix side.
Target Protein Families
Complex I 20 kDa subunit family
Target Synonyms
CI 20; CI-20kD; Complex I 20kDa subunit; Complex I mitochondrial respiratory chain 20 KD subunit; Complex I-20kD; FLJ45860; FLJ46880; MGC120002; MY017; NADH coenzyme Q reductase; NADH dehydrogenase (ubiquinone) Fe S protein 7 20kDa (NADH coenzyme Q reductase); NADH dehydrogenase (ubiquinone) FeS protein 7; 20kDa (NADHcoenzyme Q reductase) ; NADH dehydrogenase (ubiquinone) FeS protein7; 20kDa (NADHcoenzyme Q reductase); NADH dehydrogenase [ubiquinone] iron-sulfur protein 7; mitochondrial; NADH-ubiquinone oxidoreductase 20 kDa subunit; NADH:ubiquinone oxidoreductase PSST subunit ; NADHcoenzyme Q reductase; Ndufs7; NDUS7_HUMAN; PSST; PSST subunit
Target Background
This gene encodes a protein that is a subunit of one of the complexes that forms the mitochondrial respiratory chain. This protein is one of over 40 subunits found in complex I, the nicotinamide adenine dinucleotide (NADH):ubiquinone oxidoreductase. This complex functions in the transfer of electrons from NADH to the respiratory chain, and ubiquinone is believed to be the immediate electron acceptor for the enzyme. Mutations in this gene cause Leigh syndrome due to mitochondrial complex I deficiency, a severe neurological disorder that results in bilaterally symmetrical necrotic lesions in subcortical brain regions.
Notification