-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NKX3-2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human NKX3-2 (NP_001180.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NKX3-2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human NKX3-2 (NP_001180.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01787A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NKX3-2 |
| Target Synonyms | SMMD; BAPX1; NKX3B; NKX3.2; NKX3-2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T transfected with NKX3-2, Mouse spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human NKX3-2 (NP_001180.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAVRGANTLTSFSIQAILNKKEERGGLAAPEGRPAPGGTAASVAAAPAVCCWRLFGERDAGALGGAEDSLLASPAGTRTAAGRTAESPEGWDSDSALSEENESRRRCADARGASGAGLAGGSLSLGQPVCELAASKDLEEEAAGRSDSEMSASVSGDRSPRTEDDGVGPRGAHVSALCSG | Uniprot ID | P78367 |
Uniprot Id
P78367
Target Species
Human
Target Name
NKX3-2
Target Full Name
Homeobox protein Nkx-3.2
Target Function
Transcriptional repressor that acts as a negative regulator of chondrocyte maturation. PLays a role in distal stomach development; required for proper antral-pyloric morphogenesis and development of antral-type epithelium. In concert with GSC, defines the structural components of the middle ear; required for tympanic ring and gonium development and in the regulation of the width of the malleus.
Target Involvement
Spondylo-megaepiphyseal-metaphyseal dysplasia (SMMD)
Target Subcellular Location
Nucleus.
Target Protein Families
NK-3 homeobox family
Target Tissue Specificity
Expressed at highest levels in cartilage, bone (osteosarcoma) and gut (small intestine and colon), whereas moderate expression is seen in trachea and brain. Expressed in visceral mesoderm and embryonic skeleton.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
Bagpipe homeobox 1; Bagpipe homeobox homolog 1; Bagpipe homeobox protein homolog 1; Bagpipe homeobox; Drosophila; homolog of; 1; BAPX 1; Homeobox protein NK-3 homolog B; Homeobox protein Nkx 3.2; Homeobox protein Nkx-3.2; MGC138171; NK3 homeobox 2; NKX3 2; NKX3-2; NKX3.2; NKX3.2; mouse; homolog of; NKX32_HUMAN; NKX3B; OTTHUMP00000115816; SMMD
Target Background
Enables sequence-specific double-stranded DNA binding activity. Predicted to be involved in cell differentiation; negative regulation of chondrocyte differentiation; and regulation of transcription by RNA polymerase II. Predicted to act upstream of or within several processes, including animal organ development; embryonic skeletal system development; and intestinal epithelial cell development. Predicted to be part of chromatin. Predicted to be active in nucleus.
Notification