-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NOTCH2 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 1697-1819 of human NOTCH2(NP_077719.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against NOTCH2 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 1697-1819 of human NOTCH2(NP_077719.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-08342A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NOTCH2 |
| Target Synonyms | NOTCH2; AGS2; HJCYS; hN2; notch 2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse spleen | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant Protein corresponding to a sequence within amino acids 1697-1819 of human NOTCH2(NP_077719.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VIMAKRKRKHGSLWLPEGFTLRRDASNHKRREPVGQDAVGLKNLSVQVSEANLIGTGTSEHWVDDEGPQPKKVKAEDEALLSEEDDPIDRRPWTQQHLEAADIRRTPSLALTPPQAEQEVDVL | Uniprot ID | Q04721 |
Uniprot Id
Q04721
Target Species
Human
Target Name
NOTCH2
Target Full Name
Neurogenic locus notch homolog protein 2
Target Function
Functions as a receptor for membrane-bound ligands Jagged-1 (JAG1), Jagged-2 (JAG2) and Delta-1 (DLL1) to regulate cell-fate determination. Upon ligand activation through the released notch intracellular domain (NICD) it forms a transcriptional activator complex with RBPJ/RBPSUH and activates genes of the enhancer of split locus. Affects the implementation of differentiation, proliferation and apoptotic programs. Involved in bone remodeling and homeostasis. In collaboration with RELA/p65 enhances NFATc1 promoter activity and positively regulates RANKL-induced osteoclast differentiation. Positively regulates self-renewal of liver cancer cells.
Target Involvement
Alagille syndrome 2 (ALGS2); Hajdu-Cheney syndrome (HJCYS)
Target Subcellular Location
[Notch 2 extracellular truncation]: Cell membrane; Single-pass type I membrane protein.; [Notch 2 intracellular domain]: Nucleus. Cytoplasm.
Target Protein Families
NOTCH family
Target Tissue Specificity
Expressed in the brain, heart, kidney, lung, skeletal muscle and liver. Ubiquitously expressed in the embryo.
Target Synonyms
AGS2; hN2; Motch B; N2; N2ECD; N2ICD; neurogenic locus notch homolog protein 2; NOTC2_HUMAN; Notch 2; Notch 2 intracellular domain; Notch Drosophila homolog 2; Notch homolog 2; Notch homolog 2 Drosophila; Notch2
Target Background
This gene encodes a member of the Notch family. Members of this Type 1 transmembrane protein family share structural characteristics including an extracellular domain consisting of multiple epidermal growth factor-like (EGF) repeats, and an intracellular domain consisting of multiple, different domain types. Notch family members play a role in a variety of developmental processes by controlling cell fate decisions. The Notch signaling network is an evolutionarily conserved intercellular signaling pathway which regulates interactions between physically adjacent cells. In Drosophilia, notch interaction with its cell-bound ligands (delta, serrate) establishes an intercellular signaling pathway that plays a key role in development. Homologues of the notch-ligands have also been identified in human, but precise interactions between these ligands and the human notch homologues remain to be determined. This protein is cleaved in the trans-Golgi network, and presented on the cell surface as a heterodimer. This protein functions as a receptor for membrane bound ligands, and may play a role in vascular, renal and hepatic development. Two transcript variants encoding different isoforms have been found for this gene.
Notification