Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NPY4R was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human NPY4R (NP_005963.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NPY4R was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human NPY4R (NP_005963.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01768A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NPY4R |
| Target Synonyms | Y4; PP1; PPYR1; NPY4-R; NPY4R | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HT-29, MCF7, SH-SY5Y, SW480 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human NPY4R (NP_005963.4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MNTSHLLALLLPKSPQGENRSKPLGTPYNFSEHCQDSVDVMVFIVTSYSIETVVGVLGNLCLMCVTVRQKEKANVTNLLI | Uniprot ID | P50391 |
Uniprot Id
P50391
Target Species
Human
Target Name
NPY4R
Target Full Name
Neuropeptide Y receptor type 4
Target Function
Receptor for neuropeptide Y and peptide YY. The rank order of affinity of this receptor for pancreatic polypeptides is PP, PP (2-36) and [Ile-31, Gln-34] PP > [Pro-34] PYY > PYY and [Leu-31, Pro-34] NPY > NPY > PYY (3-36) and NPY (2-36) > PP (13-36) > PP (31-36) > NPY free acid.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Highest levels found in brain, coronary artery and ileum. Low levels in pancreas and kidney. Detected in colon and small intestine.
Target Synonyms
NPY4R; PPYR1; Neuropeptide Y receptor type 4; NPY4-R; Pancreatic polypeptide receptor 1; PP1
Target Background
Enables pancreatic polypeptide receptor activity and peptide hormone binding activity. Involved in G protein-coupled receptor signaling pathway. Located in membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
