Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NRXN3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 373-432 of human NRXN3 (NP_620426.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NRXN3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 373-432 of human NRXN3 (NP_620426.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01368A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NRXN3 |
| Target Synonyms | C14orf60; NRXN3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Rat liver, SGC-7901 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 373-432 of human NRXN3 (NP_620426.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ILLYAMYKYRNRDEGSYQVDETRNYISNSAQSNGTLMKEKQQSSKSGHKKQKNKDREYYV | Uniprot ID | Q9HDB5, Q9Y4C0 |
Uniprot Id
Q9HDB5, Q9Y4C0
Target Synonyms
C14orf60; NRXN3
Target Background
This gene encodes a member of a family of proteins that function in the nervous system as receptors and cell adhesion molecules. Extensive alternative splicing and the use of alternative promoters results in multiple transcript variants and protein isoforms for this gene, but the full-length nature of many of these variants has not been determined. Transcripts that initiate from an upstream promoter encode alpha isoforms, which contain epidermal growth factor-like (EGF-like) sequences and laminin G domains. Transcripts initiating from the downstream promoter encode beta isoforms, which lack EGF-like sequences. Genetic variation at this locus has been associated with a range of behavioral phenotypes, including alcohol dependence and autism spectrum disorder.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
