-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NUF2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human NUF2 (Q9BZD4) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NUF2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human NUF2 (Q9BZD4) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14329A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NUF2 |
| Target Synonyms | CDCA1; CT106; NUF2R; NUF2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, MCF7 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NUF2 (Q9BZD4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | METLSFPRYNVAEIVIHIRNKILTGADGKNLTKNDLYPNPKPEVLHMIYMRALQIVYGIRLEHFYMMPVNSEVMYPHLMEGFLPFSNLVTHLDSFLPICR | Uniprot ID | Q9BZD4 |
Uniprot Id
Q9BZD4
Target Species
Human
Target Name
NUF2
Target Full Name
Kinetochore protein Nuf2
Target Function
Acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosome segregation and spindle checkpoint activity. Required for kinetochore integrity and the organization of stable microtubule binding sites in the outer plate of the kinetochore. The NDC80 complex synergistically enhances the affinity of the SKA1 complex for microtubules and may allow the NDC80 complex to track depolymerizing microtubules.
Target Subcellular Location
Nucleus. Chromosome, centromere, kinetochore. Note=Localizes to kinetochores from late prophase to anaphase. Localizes specifically to the outer plate of the kinetochore. NDC80 is required for efficient kinetochore localization.
Target Protein Families
NUF2 family
Target Synonyms
Cancer/testis antigen 106; CDCA 1; CDCA1; Cell division cycle associated 1; Cell division cycle associated protein 1; Cell division cycle-associated protein 1; CT106; hNuf 2; hNuf2; hNuf2R; hsNuf2; Kinetochore protein Nuf2; Nuf 2; NUF2; NUF2 NDC80 kinetochore complex component ; NUF2 NDC80 kinetochore complex component homolog ; NUF2, S. cerevisiae, homolog of; NUF2_HUMAN; NUF2R
Target Background
This gene encodes a protein that is highly similar to yeast Nuf2, a component of a conserved protein complex associated with the centromere. Yeast Nuf2 disappears from the centromere during meiotic prophase when centromeres lose their connection to the spindle pole body, and plays a regulatory role in chromosome segregation. The encoded protein is found to be associated with centromeres of mitotic HeLa cells, which suggests that this protein is a functional homolog of yeast Nuf2. Alternatively spliced transcript variants that encode the same protein have been described.
Notification