-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NUP93 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 670-819 of human NUP93 (NP_055484.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NUP93 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 670-819 of human NUP93 (NP_055484.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09758A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NUP93 |
| Target Synonyms | NIC96; NUP93 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, Mouse kidney, A-431, LO2, Mouse brain, Mouse liver, Rat testis, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 670-819 of human NUP93 (NP_055484.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IAERYRAQGISANKFVDSTFYLLLDLITFFDEYHSGHIDRAFDIIERLKLVPLNQESVEERVAAFRNFSDEIRHNLSEVLLATMNILFTQFKRLKGTSPSSSSRPQRVIEDRDSQLRSQARTLITFAGMIPYRTSGDTNARLVQMEVLMN | Uniprot ID | Q8N1F7 |
Uniprot Id
Q8N1F7
Target Species
Human
Target Name
NUP93
Target Full Name
Nuclear pore complex protein Nup93
Target Function
Plays a role in the nuclear pore complex (NPC) assembly and/or maintenance. May anchor nucleoporins, but not NUP153 and TPR, to the NPC. During renal development, regulates podocyte migration and proliferation through SMAD4 signaling.
Target Involvement
Nephrotic syndrome 12 (NPHS12)
Target Subcellular Location
Nucleus membrane; Peripheral membrane protein. Nucleus, nuclear pore complex. Nucleus envelope.
Target Protein Families
Nucleoporin interacting component (NIC) family
Target Synonyms
NUP93; KIAA0095Nuclear pore complex protein Nup93; 93 kDa nucleoporin; Nucleoporin Nup93
Target Background
The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. This gene encodes a nucleoporin protein that localizes both to the basket of the pore and to the nuclear entry of the central gated channel of the pore. The encoded protein is a target of caspase cysteine proteases that play a central role in programmed cell death by apoptosis. Alternative splicing results in multiple transcript variants encoding different isoforms.
Notification