Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against OCT4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 210-310 of human 4-oct (NP_002692.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against OCT4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 210-310 of human 4-oct (NP_002692.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-13026A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | 4-Oct |
| Target Synonyms | OCT3; OCT4; OTF3; OTF4; OTF-3; Oct-3; Oct-4; Oct3/4 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse embryo | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 210-310 of human 4-oct (NP_002692.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPV | Uniprot ID | Q01860 |
Uniprot Id
Q01860
Target Species
Human
Target Name
POU5F1
Target Full Name
POU domain, class 5, transcription factor 1
Target Function
Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3'). Forms a trimeric complex with SOX2 or SOX15 on DNA and controls the expression of a number of genes involved in embryonic development such as YES1, FGF4, UTF1 and ZFP206. Critical for early embryogenesis and for embryonic stem cell pluripotency.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
POU transcription factor family, Class-5 subfamily
Target Tissue Specificity
Expressed in developing brain. Highest levels found in specific cell layers of the cortex, the olfactory bulb, the hippocampus and the cerebellum. Low levels of expression in adult tissues.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
Octamer binding transcription factor 4; MGC22487; Oct 3; Oct 4; Oct-3; Oct-4; OCT3; Oct4; Octamer binding protein 3; Octamer binding protein 4; Octamer binding transcription factor 3; Octamer-binding protein 3; Octamer-binding protein 4; Octamer-binding transcription factor 3; OTF 3; OTF 4; OTF-3; OTF3; OTF4; PO5F1_HUMAN; POU class 5 homeobox 1; POU domain class 5 transcription factor 1; POU domain transcription factor OCT4; POU domain, class 5, transcription factor 1; POU-type homeodomain-containing DNA-binding protein; POU5F1
Target Background
This gene encodes a transcription factor containing a POU homeodomain that plays a key role in embryonic development and stem cell pluripotency. Aberrant expression of this gene in adult tissues is associated with tumorigenesis. This gene can participate in a translocation with the Ewing's sarcoma gene on chromosome 21, which also leads to tumor formation. Alternative splicing, as well as usage of alternative AUG and non-AUG translation initiation codons, results in multiple isoforms. One of the AUG start codons is polymorphic in human populations. Related pseudogenes have been identified on chromosomes 1, 3, 8, 10, and 12.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
