Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against OGDHL was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human OGDHL (NP_060715.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against OGDHL was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human OGDHL (NP_060715.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-10091A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | OGDHL |
| Target Synonyms | YOBELN; OGDHL | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, LO2, Mouse brain, Rat kidney | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human OGDHL (NP_060715.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSQLRLLPSRLGVQAARLLAAHDVPVFGWRSRSSGPPATFPSSKGGGGSSYMEEMYFAWLENPQSVHKSWDSFFREASEEAFSGSAQPRPPSVVHESRSAVSSRTKTSKL | Uniprot ID | Q9ULD0 |
Uniprot Id
Q9ULD0
Target Species
Human
Target Name
OGDHL
Target Full Name
2-oxoglutarate dehydrogenase-like, mitochondrial
Target Function
2-oxoglutarate dehydrogenase (E1-like) component of the 2-oxoglutarate dehydrogenase multienzyme complex (OGDHC) which mediates the decarboxylation of alpha-ketoglutarate in the tricarboxylic acid cycle. The OGDHC complex catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO(2) while reducing NAD(+) to NADH. The OGDHC complex is mainly active in the mitochondrion. Involved in the inhibition of cell proliferation and in apoptosis.
Target Subcellular Location
Mitochondrion matrix.
Target Protein Families
Alpha-ketoglutarate dehydrogenase family
Target Tissue Specificity
Expressed in the brain and the liver.
Target Synonyms
2-oxoglutarate dehydrogenase complex component E1-like; 2-oxoglutarate dehydrogenase-like, mitochondrial; Alpha-ketoglutarate dehydrogenase-like; KIAA1290; OGDC-E1-like; OGDHL; OGDHL_HUMAN
Target Background
The protein encoded by this gene is similar to oxoglutarate dehydrogenase (OGDH) of the OGDH complex, which degrades glucose and glutamate. This gene encodes several isoforms, including some that appear to localize to mitochondria. The encoded protein down-regulates the AKT signaling cascade and can suppress the growth of cervical cancer cells.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
