-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against OSGIN1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human OSGIN1 (NP_892026.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against OSGIN1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human OSGIN1 (NP_892026.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04806A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | OSGIN1 |
| Target Synonyms | BDGI; OKL38; OSGIN1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human OSGIN1 (NP_892026.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSSSRKDHLGASSSEPLPVIIVGNGPSGICLSYLLSGYTPYTKPDAIHPHPLLQRKLTEAPGVSILDQDLDYLSEGLEGRSQSPVALLFDALLRPDTDFGGNMKSVLTWKHRKEHAIPHVVLGRNLPGGAWHSIEGSMVILSQGQWMGLPDLEVKDWMQKKRRGLRNSRATAGDIAHYYRDYVVKKGLGHNFVSGAVVTA | Uniprot ID | Q9UJX0 |
Uniprot Id
Q9UJX0
Target Species
Human
Target Name
OSGIN1
Target Full Name
Oxidative stress-induced growth inhibitor 1
Target Function
Regulates the differentiation and proliferation through the regulation of cell death.
Target Protein Families
OKL38 family
Target Tissue Specificity
Ubiquitous. Highest expression in the ovary, testis, kidney, skeletal muscle and liver. Weakly expressed in spleen, heart, kidney, and pancreas. Highly expressed in tumor cells (at protein level).
Target Synonyms
OSGIN1; BDGI; OKL38; Oxidative stress-induced growth inhibitor 1; Bone marrow stromal cell-derived growth inhibitor; BMSC-derived growth inhibitor; Ovary; kidney and liver protein 38; huOKL38; Pregnancy-induced growth inhibitor OKL38
Target Background
This gene encodes an oxidative stress response protein that regulates cell death. Expression of the gene is regulated by p53 and is induced by DNA damage. The protein regulates apoptosis by inducing cytochrome c release from mitochondria. It also appears to be a key regulator of both inflammatory and anti-inflammatory molecules. The loss of this protein correlates with uncontrolled cell growth and tumor formation. Naturally occurring read-through transcription exists between this gene and the neighboring upstream malonyl-CoA decarboxylase (MLYCD) gene, but the read-through transcripts are unlikely to produce a protein product.
Notification