Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against OXSR1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human OXSR1 (NP_005100.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against OXSR1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human OXSR1 (NP_005100.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-05260A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | OXSR1 |
| Target Synonyms | OSR1; OXSR1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Jurkat, U-251MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human OXSR1 (NP_005100.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSEDSSALPWSINRDDYELQEVIGSGATAVVQAAYCAPKKEKVAIKRINLEKCQTSMDELLKEIQAMSQCHHPNIVSYYTSFVVKDELWLVMKLLSGGSV | Uniprot ID | O95747 |
Uniprot Id
O95747
Target Species
Human
Target Name
OXSR1
Target Full Name
Serine/threonine-protein kinase OSR1
Target Function
Phosphorylates RELL1, RELL2 and RELT. Phosphorylates PAK1. Phosphorylates PLSCR1 in the presence of RELT.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Protein kinase superfamily, STE Ser/Thr protein kinase family, STE20 subfamily
Target Tissue Specificity
Ubiquitously expressed in all tissue examined.
Target Synonyms
2210022N24Rik; 2810422B09Rik; AI462649; AW209236; KIAA1101; mKIAA1101; OSR 1; OSR1; OTTHUMP00000209062; Oxidative stress responsive 1; Oxidative stress responsive 1 protein; Oxidative stress-responsive 1 protein; OXSR 1; OXSR1; OXSR1_HUMAN; Serine/threonine protein kinase OSR1; Serine/threonine-protein kinase OSR1
Target Background
The product of this gene belongs to the Ser/Thr protein kinase family of proteins. It regulates downstream kinases in response to environmental stress, and may play a role in regulating the actin cytoskeleton.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
