Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against P2RX3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 328-397 of human P2RX3 (NP_002550.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against P2RX3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 328-397 of human P2RX3 (NP_002550.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11816A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | P2RX3 |
| Target Synonyms | P2X3; P2RX3 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat heart, Mouse liver, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 328-397 of human P2RX3 (NP_002550.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AFTSVGVGTVLCDIILLNFLKGADQYKAKKFEEVNETTLKIAALTNPVYPSDQTTAEKQSTDSGAFSIGH | Uniprot ID | P56373 |
Uniprot Id
P56373
Target Species
Human
Target Name
P2RX3
Target Full Name
P2X purinoceptor 3
Target Function
Receptor for ATP that acts as a ligand-gated cation channel. Plays a role in sensory perception. Required for normal perception of pain. Required for normal taste perception.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
P2X receptor family
Target Synonyms
ATP receptor; MGC129956; P2rx3; P2RX3_HUMAN; P2X purinoceptor 3; P2X receptor subunit 3; P2X3; Purinergic receptor; Purinergic receptor P2X ligand gated ion channel 3; Purinergic receptor P2X3; Purinoceptor P2X3
Target Background
This gene encodes a member of the P2X purinergic receptor (purinoceptor) gene family which includes seven members (P2RX1 - P2RX7). P2X purinoceptors are a family of cation-permeable, ligand-gated ion channels that open in response to the binding of extracellular adenosine 5'-triphosphate (ATP). The encoded protein is a subunit of the trimeric P2X3 receptor ion channel which is expressed by sensory or autonomic neurons. A deficiency of the orthologous protein in mice is associated with reduced pain-related behavior and urinary bladder hyporeflexia.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
