Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against P2RX5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 341-422 of human P2RX5 (NP_002552.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against P2RX5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 341-422 of human P2RX5 (NP_002552.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-02032A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | P2RX5 |
| Target Synonyms | P2X5; LRH-1; P2X5R; P2RX5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, Rat heart, BxPC-3, K-562, Mouse skeletal muscle, NCI-H460, Raji, U-87MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 341-422 of human P2RX5 (NP_002552.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KKREFYRDKKYEEVRGLEDSSQEAEDEASGLGLSEQLTSGPGLLGMPEQQELQEPPEAKRGSSSQKGNGSVCPQLLEPHRST | Uniprot ID | Q93086 |
Uniprot Id
Q93086
Target Species
Human
Target Name
P2RX5
Target Full Name
P2X purinoceptor 5
Target Function
Receptor for ATP that acts as a ligand-gated ion channel.
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
P2X receptor family
Target Tissue Specificity
Expressed at high levels in brain and immune system.
Target Synonyms
ATP receptor; ATP receptor subunit; Ionotropic ATP receptor P2X5; LRH 1; LRH1; Lymphoid restricted histocompatibility antigen 1; MGC47755; P2rx5; P2RX5_HUMAN; P2X purinoceptor 5; P2X5; P2X5R; Purinergic receptor; Purinergic receptor P2X ligand gated ion channel 5; Purinergic receptor P2X5
Target Background
The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the neighboring downstream gene, TAX1BP3 (Tax1 binding protein 3).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
