Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against P2RY10 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human P2RY10 (NP_001311147.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against P2RY10 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human P2RY10 (NP_001311147.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00238A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | P2RY10 |
| Target Synonyms | LPS2; P2Y10; LYPSR2; P2RY10 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, Jurkat, K-562, Mouse liver, Mouse thymus, Rat liver, Rat thymus, U-251MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human P2RY10 (NP_001311147.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TVAELAGFVIPVIIIAWCTWKTTISLRQPPMAFQGISERQKALRMVFMCAAVFFICFTPYHINFIFYTMVKETIISSCPVVRIALYFHPFCLCLASLCCLLDPILYYFMASEFRDQLSRHGSSVTRSRLMSKESGSSMIG | Uniprot ID | O00398 |
Uniprot Id
O00398
Target Species
Human
Target Name
P2RY10
Target Full Name
Putative P2Y purinoceptor 10
Target Function
Putative receptor for purines coupled to G-proteins.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Weakly expressed in blood leukocytes.
Target Synonyms
P2RY10; Putative P2Y purinoceptor 10; P2Y10; P2Y-like receptor
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
