-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PADI4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 374-560 of human PADI4 (NP_036519.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against PADI4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 374-560 of human PADI4 (NP_036519.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-11902A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PADI4 |
| Target Synonyms | PAD; PAD4; PDI4; PDI5; PADI5; PADI4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A549, U-87 MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 374-560 of human PADI4 (NP_036519.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RGLKEFPIKRVMGPDFGYVTRGPQTGGISGLDSFGNLEVSPPVTVRGKEYPLGRILFGDSCYPSNDSRQMHQALQDFLSAQQVQAPVKLYSDWLSVGHVDEFLSFVPAPDRKGFRLLLASPRSCYKLFQEQQNEGHGEALLFEGIKKKKQQKIKNILSNKTLREHNSFVERCIDWNRELLKRELGLA | Uniprot ID | Q9UM07 |
Uniprot Id
Q9UM07
Target Species
Human
Target Name
PADI4
Target Full Name
Protein-arginine deiminase type-4
Target Function
Catalyzes the citrullination/deimination of arginine residues of proteins such as histones, thereby playing a key role in histone code and regulation of stem cell maintenance. Citrullinates histone H1 at 'Arg-54' (to form H1R54ci), histone H3 at 'Arg-2', 'Arg-8', 'Arg-17' and/or 'Arg-26' (to form H3R2ci, H3R8ci, H3R17ci, H3R26ci, respectively) and histone H4 at 'Arg-3' (to form H4R3ci). Acts as a key regulator of stem cell maintenance by mediating citrullination of histone H1: citrullination of 'Arg-54' of histone H1 (H1R54ci) results in H1 displacement from chromatin and global chromatin decondensation, thereby promoting pluripotency and stem cell maintenance. Promotes profound chromatin decondensation during the innate immune response to infection in neutrophils by mediating formation of H1R54ci. Required for the formation of neutrophil extracellular traps (NETs); NETs are mainly composed of DNA fibers and are released by neutrophils to bind pathogens during inflammation. Citrullination of histone H3 prevents their methylation by CARM1 and HRMT1L2/PRMT1 and represses transcription. Citrullinates EP300/P300 at 'Arg-2142', which favors its interaction with NCOA2/GRIP1.
Target Involvement
Rheumatoid arthritis (RA)
Target Subcellular Location
Cytoplasm. Nucleus. Cytoplasmic granule.
Target Protein Families
Protein arginine deiminase family
Target Tissue Specificity
Expressed in eosinophils and neutrophils, not expressed in peripheral monocytes or lymphocytes.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
EC 3.5.3.15; HL 60 PAD; HL-60 PAD; PAD 4; PAD; PADI 4; PADI 5; PADI H protein; Padi4; PADI4_HUMAN; PADI5; PDI 4; PDI 5; PDI4; PDI5; Peptidyl arginine deiminase type IV; Peptidyl arginine deiminase type V; Peptidylarginine deiminase IV; Protein arginine deiminase; Protein arginine deiminase type 4; Protein arginine deiminase type IV; Protein-arginine deiminase type IV; Protein-arginine deiminase type-4
Target Background
This gene is a member of a gene family which encodes enzymes responsible for the conversion of arginine residues to citrulline residues. This gene may play a role in granulocyte and macrophage development leading to inflammation and immune response.
Notification