-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PAR4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human PAR4 (NP_002574.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PAR4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human PAR4 (NP_002574.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04198A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PAR4 |
| Target Synonyms | PAR4; Par-4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | BT-474, HepG2, HT-29, SKOV3, SW480 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PAR4 (NP_002574.2) | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QNEAVNLLDPGSSYLLQEPPRTVSGRYKSTTSVSEEDVSSRYSRTDRSGFPRYNRDANVSGTLVSSSTLEKKIEDLEKEVVRERQENLRLVRLMQDKEEMI | Uniprot ID | Q96IZ0 |
Uniprot Id
Q96IZ0
Target Species
Human
Target Name
PAWR
Target Full Name
PRKC apoptosis WT1 regulator protein
Target Function
Pro-apoptotic protein capable of selectively inducing apoptosis in cancer cells, sensitizing the cells to diverse apoptotic stimuli and causing regression of tumors in animal models. Induces apoptosis in certain cancer cells by activation of the Fas prodeath pathway and coparallel inhibition of NF-kappa-B transcriptional activity. Inhibits the transcriptional activation and augments the transcriptional repression mediated by WT1. Down-regulates the anti-apoptotic protein BCL2 via its interaction with WT1. Seems also to be a transcriptional repressor by itself. May be directly involved in regulating the amyloid precursor protein (APP) cleavage activity of BACE1.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Tissue Specificity
Widely expressed. Expression is elevated in various neurodegenerative diseases such as amyotrophic lateral sclerosis, Alzheimer, Parkinson and Huntington diseases and stroke. Down-regulated in several cancers.
Target Synonyms
2310001G03Rik; PAR 4; PAR-4; Pawr; PAWR_HUMAN; PRKC Apoptosis WT1 Regulator; PRKC apoptosis WT1 regulator protein; Prostate apoptosis response 4 protein; Prostate apoptosis response protein 4; prostate apoptosis response protein PAR-4; Transcriptional repressor Par-4-like protein PAWR; Transcriptional repressor PAR4; WT1 Interacting Protein
Target Background
This gene encodes a tumor suppressor protein that selectively induces apoptosis in cancer cells through intracellular and extracellular mechanisms. The intracellular mechanism involves the inhibition of pro-survival pathways and the activation of Fas-mediated apoptosis, while the extracellular mechanism involves the binding of a secreted form of this protein to glucose regulated protein 78 (GRP78) on the cell surface, which leads to activation of the extrinsic apoptotic pathway. This gene is located on the unstable human chromosomal 12q21 region and is often deleted or mutated different tumors. The encoded protein also plays an important role in the progression of age-related diseases.
Notification