-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PARD6A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PARD6A (Q9NPB6) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PARD6A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PARD6A (Q9NPB6) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04196A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PARD6A |
| Target Synonyms | PAR6; PAR6C; TAX40; PAR-6A; TIP-40; PAR6alpha; PARD6A | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HT-29, Jurkat, Mouse testis, Raji, SW620, U-251MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PARD6A (Q9NPB6). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MARPQRTPARSPDSIVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAVHQIPGLDVLLGYTDAHGDLLPLTNDDSLHRALASGPPPLRLLVQKRAEADS | Uniprot ID | Q9NPB6 |
Uniprot Id
Q9NPB6
Target Species
Human
Target Name
PARD6A
Target Full Name
Partitioning defective 6 homolog alpha
Target Function
Adapter protein involved in asymmetrical cell division and cell polarization processes. Probably involved in the formation of epithelial tight junctions. Association with PARD3 may prevent the interaction of PARD3 with F11R/JAM1, thereby preventing tight junction assembly. The PARD6-PARD3 complex links GTP-bound Rho small GTPases to atypical protein kinase C proteins. Regulates centrosome organization and function. Essential for the centrosomal recruitment of key proteins that control centrosomal microtubule organization.
Target Subcellular Location
Cytoplasm. Cell membrane. Cell projection, ruffle. Cell junction, tight junction. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriolar satellite. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome.
Target Protein Families
PAR6 family
Target Tissue Specificity
Expressed in pancreas, skeletal muscle, brain and heart. Weakly expressed in kidney and placenta.
Target Synonyms
0710008C04Rik; 2610010A15Rik; Par 6 partitioning defective 6 C elegans homolog alpha; Par 6 partitioning defective 6 homolog alpha; Par 6 partitioning defective 6 homolog alpha C elegans; PAR 6A; PAR-6 alpha; PAR-6; par-6 family cell polarity regulator alpha; PAR-6A; PAR6; PAR6A_HUMAN; PAR6alpha; PAR6C; Pard6a; Partitioning defective 6 homolog alpha; partitioning-defective protein 6; partitioning-defective protein 6, C. elegans, homolog of, alpha; Tax interacting protein 40; Tax interaction protein 40; TAX40; TIP 40; TIP-40; TIP40
Target Background
This gene is a member of the PAR6 family and encodes a protein with a PSD95/Discs-large/ZO1 (PDZ) domain and a semi-Cdc42/Rac interactive binding (CRIB) domain. This cell membrane protein is involved in asymmetrical cell division and cell polarization processes as a member of a multi-protein complex. The protein also has a role in the epithelial-to-mesenchymal transition (EMT) that characterizes the invasive phenotype associated with metastatic carcinomas. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Notification