Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PBX3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PBX3 (NP_006186.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PBX3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PBX3 (NP_006186.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06916A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PBX3 |
| Target Synonyms | PBX3 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PBX3 (NP_006186.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDDQSRMLQTLAGVNLAGHSVQGGMALPPPPHGHEGADGDGRKQDIGDILHQIMTITDQSLDEAQAKKHALNCHRMKPALFSVLCEIKEKTGLSIRGAQE | Uniprot ID | P40426 |
Uniprot Id
P40426
Target Species
Human
Target Name
PBX3
Target Full Name
Pre-B-cell leukemia transcription factor 3
Target Function
Transcriptional activator that binds the sequence 5'-ATCAATCAA-3'.
Target Subcellular Location
Nucleus.
Target Protein Families
TALE/PBX homeobox family
Target Tissue Specificity
Ubiquitously expressed.
Target Synonyms
Homeobox protein PBX3; MGC134053 ; OTTHUMP00000064213; Pbx 3; Pbx3; PBX3_HUMAN; Pre B cell leukemia homeobox 3; Pre B cell leukemia transcription factor 3; Pre-B-cell leukemia transcription factor 3; RP11 336P12.1
Target Background
Predicted to enable DNA-binding transcription factor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in animal organ development; neuron development; and regulation of transcription by RNA polymerase II. Predicted to act upstream of or within several processes, including adult locomotory behavior; dorsal spinal cord development; and regulation of respiratory gaseous exchange by nervous system process. Predicted to be located in nucleus. Predicted to be part of chromatin.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
