-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PCGF2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 115-241 of human PCGF2 (NP_009075.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PCGF2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 115-241 of human PCGF2 (NP_009075.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02070A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PCGF2 |
| Target Synonyms | TPFS; MEL-18; RNF110; ZNF144; PCGF2 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 115-241 of human PCGF2 (NP_009075.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GEVLEQEKGALSDDEIVSLSIEFYEGARDRDEKKGPLENGDGDKEKTGVRFLRCPAAMTVMHLAKFLRNKMDVPSKYKVEVLYEDEPLKEYYTLMDIAYIYPWRRNGPLPLKYRVQPACKRLTLATV | Uniprot ID | P35227 |
Uniprot Id
P35227
Target Species
Human
Target Name
PCGF2
Target Full Name
Polycomb group RING finger protein 2
Target Function
Transcriptional repressor. Binds specifically to the DNA sequence 5'-GACTNGACT-3'. Has tumor suppressor activity. May play a role in control of cell proliferation and/or neural cell development. Regulates proliferation of early T progenitor cells by maintaining expression of HES1. Also plays a role in antero-posterior specification of the axial skeleton and negative regulation of the self-renewal activity of hematopoietic stem cells. Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. Within the PRC1-like complex, regulates RNF2 ubiquitin ligase activity.
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Detected in all tissues examined with high expression found in placenta lung and kidney and low expression, in liver, pancreas and skeletal muscle.
Target Synonyms
DNA binding protein Mel 18; DNA-binding protein Mel-18; Mel 18; MGC10545; PCGF 2; PCGF2; PCGF2_HUMAN; Polycomb group ring finger 2; Polycomb group RING finger protein 2; RING finger protein 110; RNF110; Zinc finger protein 144; ZNF 144; ZNF144
Target Background
The protein encoded by this gene contains a RING finger motif and is similar to the polycomb group (PcG) gene products. PcG gene products form complexes via protein-protein interaction and maintain the transcription repression of genes involved in embryogenesis, cell cycles, and tumorigenesis. This protein was shown to act as a negative regulator of transcription and has tumor suppressor activity. The expression of this gene was detected in various tumor cells, but is limited in neural organs in normal tissues. Knockout studies in mice suggested that this protein may negatively regulate the expression of different cytokines, chemokines, and chemokine receptors, and thus plays an important role in lymphocyte differentiation and migration, as well as in immune responses.
Notification