Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PCNX1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 2250-2341 of human PCNX1 (NP_055797.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PCNX1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 2250-2341 of human PCNX1 (NP_055797.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06995A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PCNX1 |
| Target Synonyms | PCNX; PCNXL1; pecanex; PCNX1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, U-87MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 2250-2341 of human PCNX1 (NP_055797.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VDPSQILEGINLSKRKELQWPDEGIRLKAGRNSWKDWSPQEGMEGHVIHRWVPCSRDPGTRSHIDKAVLLVQIDDKYVTVIETGVLELGAEV | Uniprot ID | Q96RV3 |
Uniprot Id
Q96RV3
Target Species
Human
Target Name
PCNX1
Target Full Name
Pecanex-like protein 1
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
Pecanex family
Target Synonyms
PCNX1; KIAA0805; KIAA0995; PCNX; PCNXL1; Pecanex-like protein 1; Pecanex homolog protein 1
Target Background
This gene encodes an evolutionarily conserved transmembrane protein similar to the pecanex protein in Drosophila. The fly protein is a component of the Notch signaling pathway, which functions in several developmental processes.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
