-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PDE1C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 435-634 of human PDE1C (NP_001177985.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PDE1C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 435-634 of human PDE1C (NP_001177985.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05285A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PDE1C |
| Target Synonyms | Hcam3; DFNA74; hCam-3; cam-PDE 1C; PDE1C | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat brain, Rat heart, HepG2, Mouse brain, Mouse testis, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 435-634 of human PDE1C (NP_001177985.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKRSGVKTSGSEGSAPINNSVISVDYKSFKATWTEVVHINRERWRAKVPKEEKAKKEAEEKARLAAEEQQKEMEAKSQAEEGASGKAEKKTSGETKNQVNGTRANKSDNPRGKNSKAEKSSGEQQQNGDFKDGKNKTDKKDHSNIGNDSKKTDDSQE | Uniprot ID | Q14123 |
Uniprot Id
Q14123
Target Species
Human
Target Name
PDE1C
Target Full Name
Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1C
Target Function
Calmodulin-dependent cyclic nucleotide phosphodiesterase with a dual-specificity for the second messengers cAMP and cGMP, which are key regulators of many important physiological processes. Has a high affinity for both cAMP and cGMP. Modulates the amplitude and duration of the cAMP signal in sensory cilia in response to odorant stimulation, hence contributing to the generation of action potentials. Regulates smooth muscle cell proliferation. Regulates the stability of growth factor receptors, including PDGFRB (Probable).
Target Protein Families
Cyclic nucleotide phosphodiesterase family, PDE1 subfamily
Target Tissue Specificity
Isoform PDE1C2 is present in the heart and brain and, at lower levels in the lung, liver, kidney and skeletal muscle. Isoform PDE1C1 is expressed in the heart and brain and, at lower levels in lung. Also expressed at low levels in uterus and testis.
Target Synonyms
5''-cyclic nucleotide phosphodiesterase 1C; Calcium/calmodulin dependent 3'5' cyclic nucleotide phosphodiesterase 1C; Calcium/calmodulin-dependent 3''; Cam PDE 1C; Cam-PDE 1C; hCam 3; hCam-3; HCAM3; HSPDE1C1A; Human 3'5' cyclic nucleotide Phosphodiesterase; PDE 1C; Pde1c; PDE1C_HUMAN; Phosphodiesterase 1C; Phosphodiesterase 1C calmodulin dependent ; Phosphodiesterase 1C calmodulin dependent 70kDa
Target Background
This gene encodes an enzyme that belongs to the 3'5'-cyclic nucleotide phosphodiesterase family. Members of this family catalyze hydrolysis of the cyclic nucleotides, cyclic adenosine monophosphate and cyclic guanosine monophosphate, to the corresponding nucleoside 5'-monophosphates. The enzyme encoded by this gene regulates proliferation and migration of vascular smooth muscle cells, and neointimal hyperplasia. This enzyme also plays a role in pathological vascular remodeling by regulating the stability of growth factor receptors, such as PDGF-receptor-beta.
Notification