-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PDIA2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 326-525 of human PDIA2 (NP_006840.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against PDIA2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 326-525 of human PDIA2 (NP_006840.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-03238A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PDIA2 |
| Target Synonyms | PDI; PDA2; PDIP; PDIR; PDIA2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Rat liver, U-87MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 326-525 of human PDIA2 (NP_006840.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FGLKAEAAPTLRLVNLETTKKYAPVDGGPVTAASITAFCHAVLNGQVKPYLLSQEIPPDWDQRPVKTLVGKNFEQVAFDETKNVFVKFYAPWCTHCKEMAPAWEALAEKYQDHEDIIIAELDATANELDAFAVHGFPTLKYFPAGPGRKVIEYKSTRDLETFSKFLDNGGVLPTEEPPEEPAAPFPEPPANSTMGSKEEL | Uniprot ID | Q13087 |
Uniprot Id
Q13087
Target Species
Human
Target Name
PDIA2
Target Full Name
Protein disulfide-isomerase A2
Target Function
Acts as an intracellular estrogen-binding protein. May be involved in modulating cellular levels and biological functions of estrogens in the pancreas. May act as a chaperone that inhibits aggregation of misfolded proteins.
Target Subcellular Location
Endoplasmic reticulum lumen.
Target Protein Families
Protein disulfide isomerase family
Target Tissue Specificity
Highly expressed in pancreas (at protein level).
Target Synonyms
Pancreas specific protein disulfide isomerase; Pancreas-specific protein disulfide isomerase; Pancreatic protein disulfide isomerase; PDA2; PDI; PDIA2; PDIA2_HUMAN; PDIp; PDIR; Protein disulfide isomerase A2; Protein disulfide isomerase; Protein disulfide isomerase associated 2; Protein disulfide isomerase family A member 2; Protein disulfide isomerase pancreatic; Protein disulfide-isomerase A2; Rho GDP dissociation inhibitor gamma
Target Background
This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, two catalytically active thioredoxin (TRX) domains, two TRX-like domains and a C-terminal ER-retention sequence. The protein plays a role in the folding of nascent proteins in the endoplasmic reticulum by forming disulfide bonds through its thiol isomerase, oxidase, and reductase activity. The encoded protein also possesses estradiol-binding activity and can modulate intracellular estradiol levels.
Notification