-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PDK3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 307-406 of human PDK3 (NP_005382.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
The antibody against PDK3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 307-406 of human PDK3 (NP_005382.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
| Cat.No | ADA-08465A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Pdk3 |
| Target Synonyms | CMTX6; GS1-358P8.4; PDK3 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 307-406 of human PDK3 (NP_005382.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TAPRPSLEPTRAAPLAGFGYGLPISRLYARYFQGDLKLYSMEGVGTDAVIYLKALSSESFERLPVFNKSAWRHYKTTPEADDWSNPSSEPRDASKYKAKQ | Uniprot ID | Q15120 |
Uniprot Id
Q15120
Target Species
Human
Target Name
PDK3
Target Full Name
[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 3, mitochondrial
Target Function
Inhibits pyruvate dehydrogenase activity by phosphorylation of the E1 subunit PDHA1, and thereby regulates glucose metabolism and aerobic respiration. Can also phosphorylate PDHA2. Decreases glucose utilization and increases fat metabolism in response to prolonged fasting, and as adaptation to a high-fat diet. Plays a role in glucose homeostasis and in maintaining normal blood glucose levels in function of nutrient levels and under starvation. Plays a role in the generation of reactive oxygen species.
Target Involvement
Charcot-Marie-Tooth disease, X-linked dominant, 6 (CMTX6)
Target Subcellular Location
Mitochondrion matrix.
Target Protein Families
PDK/BCKDK protein kinase family
Target Tissue Specificity
Expressed in heart, skeletal muscle, spinal cord, as well as fetal and adult brain.
Target Synonyms
[Pyruvate dehydrogenase [lipoamide] kinase isozyme 3 mitochondrial; [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 3; CMTX6; GS1-358P8.4; mitochondrial; PDK3; PDK3_HUMAN; Pyruvate dehydrogenase kinase isoenzyme 3; Pyruvate dehydrogenase kinase isoform 3; Pyruvate dehydrogenase kinase isozyme 3; Pyruvate dehydrogenase lipoamide kinase isozyme 3 mitochondrial
Target Background
The pyruvate dehydrogenase (PDH) complex is a nuclear-encoded mitochondrial multienzyme complex that catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2). It provides the primary link between glycolysis and the tricarboxylic acid (TCA) cycle, and thus is one of the major enzymes responsible for the regulation of glucose metabolism. The enzymatic activity of PDH is regulated by a phosphorylation/dephosphorylation cycle, and phosphorylation results in inactivation of PDH. The protein encoded by this gene is one of the three pyruvate dehydrogenase kinases that inhibits the PDH complex by phosphorylation of the E1 alpha subunit. This gene is predominantly expressed in the heart and skeletal muscles. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Notification