-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Peroxiredoxin 1/PAG was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Peroxiredoxin 1/PAG (Q06830) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Peroxiredoxin 1/PAG was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Peroxiredoxin 1/PAG (Q06830) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13926A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Peroxiredoxin 1/PAG |
| Target Synonyms | PAG; PAGA; PAGB; PRX1; PRXI; MSP23; NKEFA; TDPX2; NKEF-A; Peroxiredoxin 1/PAG | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HepG2, MCF7, Mouse brain, Mouse liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Peroxiredoxin 1/PAG (Q06830). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPM | Uniprot ID | Q06830 |
Uniprot Id
Q06830
Target Species
Human
Target Name
PRDX1
Target Full Name
Peroxiredoxin-1
Target Function
Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2). Reduces an intramolecular disulfide bond in GDPD5 that gates the ability to GDPD5 to drive postmitotic motor neuron differentiation.
Target Subcellular Location
Cytoplasm. Melanosome. Note=Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
Target Protein Families
Peroxiredoxin family, AhpC/Prx1 subfamily
Target Research Area
Cardiovascular, Cell Biology, Metabolism
Target Synonyms
Heme binding 23 kDa protein; MSP23; Natural killer cell-enhancing factor A; NKEF A; NKEF-A; NKEFA; OSF3; Osteoblast specific factor 3; PAG; Paga; PAGB; Peroxiredoxin 1; Peroxiredoxin-1; PRDX1; PRDX1_HUMAN; Proliferation associated gene A ; Proliferation-associated gene protein; PRX1; PrxI; TDPX2; Thioredoxin peroxidase 2; Thioredoxin-dependent peroxide reductase 2
Target Background
This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in cells, and may contribute to the antiviral activity of CD8(+) T-cells. This protein may have a proliferative effect and play a role in cancer development or progression. Four transcript variants encoding the same protein have been identified for this gene.
Notification