Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PEX2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human PEX2 (NP_001165558.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against PEX2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human PEX2 (NP_001165558.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-05150A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PEX2 |
| Target Synonyms | PAF1; PMP3; ZWS3; PBD5A; PBD5B; PMP35; PXMP3; RNF72; PEX2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, NIH/3T3, Rat brain, 293T, LO2, Mouse brain, Mouse liver, Rat liver, U-251MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human PEX2 (NP_001165558.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MASRKENAKSANRVLRISQLDALELNKALEQLVWSQFTQCFHGFKPGLLARFEPEVKACLWVFLWRFTIYSKNATVGQSVLNIKYKNDFSPNLRYQPPSKNQKIWYAVCTIGGRWLEERCYDLFRNHHLA | Uniprot ID | P28328 |
Uniprot Id
P28328
Target Species
Human
Target Name
PEX2
Target Full Name
Peroxisome biogenesis factor 2
Target Function
Somewhat implicated in the biogenesis of peroxisomes.
Target Involvement
Peroxisome biogenesis disorder complementation group 5 (PBD-CG5); Peroxisome biogenesis disorder 5A (PBD5A); Peroxisome biogenesis disorder 5B (PBD5B)
Target Subcellular Location
Peroxisome membrane; Multi-pass membrane protein.
Target Protein Families
Pex2/pex10/pex12 family
Target Synonyms
PEX2; PAF1; PMP3; PMP35; PXMP3; RNF72; Peroxisome biogenesis factor 2; 35 kDa peroxisomal membrane protein; Peroxin-2; Peroxisomal membrane protein 3; Peroxisome assembly factor 1; PAF-1; RING finger protein 72
Target Background
This gene encodes an integral peroxisomal membrane protein required for peroxisome biogenesis. The protein is thought to be involved in peroxisomal matrix protein import. Mutations in this gene result in one form of Zellweger syndrome and infantile Refsum disease. Alternative splicing results in multiple transcript variants encoding the same protein.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
