Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PFN2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-140 of human PFN2 (P35080) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PFN2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-140 of human PFN2 (P35080) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11259A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PFN2 |
| Target Synonyms | PFL; D3S1319E; PFN2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, BT-474, Mouse skeletal muscle, SW480, U-251MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-140 of human PFN2 (P35080). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF | Uniprot ID | P35080 |
Uniprot Id
P35080
Target Species
Human
Target Name
PFN2
Target Full Name
Profilin-2
Target Function
Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG.
Target Subcellular Location
Cytoplasm, cytoskeleton.
Target Protein Families
Profilin family
Target Tissue Specificity
Highly expressed in brain, skeletal muscle and kidney and less strongly in heart, placenta, lung and liver.
Target Synonyms
D3S1319E; PFL; PFN 2; Pfn2; PROF2_HUMAN; Profilin II; Profilin-2; Profilin2; ProfilinII
Target Background
The protein encoded by this gene is a ubiquitous actin monomer-binding protein belonging to the profilin family. It is thought to regulate actin polymerization in response to extracellular signals. There are two alternatively spliced transcript variants encoding different isoforms described for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
