-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PI4KA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1780-1860 of human PI4KA (P42356) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against PI4KA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1780-1860 of human PI4KA (P42356) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-11232A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PI4KA |
| Target Synonyms | SPG84; GIDID2; PIK4CA; PMGYCHA; pi4K230; PI4K-ALPHA; PI4KA | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, NIH/3T3, Rat brain, Mouse brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1780-1860 of human PI4KA (P42356). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PEAIVLDIDYKSGTPMQSAAKAPYLAKFKVKRCGVSELEKEGLRCRSDSEDECSTQEADGQKISWQAAIFKVGDDCRQDML | Uniprot ID | P42356 |
Uniprot Id
P42356
Target Species
Human
Target Name
PI4KA
Target Full Name
Phosphatidylinositol 4-kinase alpha
Target Function
Acts on phosphatidylinositol (PtdIns) in the first committed step in the production of the second messenger inositol-1,4,5,-trisphosphate.
Target Involvement
Polymicrogyria, perisylvian, with cerebellar hypoplasia and arthrogryposis (PMGYCHA)
Target Subcellular Location
Cytoplasm. Cell membrane.
Target Protein Families
PI3/PI4-kinase family, Type III PI4K subfamily
Target Tissue Specificity
Expressed ubiquitously. Highest levels in placenta and brain. Little or no expression in lung, liver, pancreas, testis or leukocytes.
Target Synonyms
EC 2.7.1.67 ; Phosphatidylinositol 4 kinase alpha; Phosphatidylinositol 4 kinase catalytic alpha polypeptide; Phosphatidylinositol 4-kinase alpha; PI4 kinase; PI4-kinase alpha; PI4K ALPHA ; PI4K-alpha; pi4K230; PI4KA; PI4KA_HUMAN; PIK4; PIK4CA; PtdIns 4 kinase; PtdIns-4-kinase alpha
Target Background
This gene encodes a phosphatidylinositol (PI) 4-kinase which catalyzes the first committed step in the biosynthesis of phosphatidylinositol 4, 5-bisphosphate. The mammalian PI 4-kinases have been classified into two types, II and III, based on their molecular mass, and modulation by detergent and adenosine. The protein encoded by this gene is a type III enzyme that is not inhibited by adenosine. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Notification