-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PIK3CG was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 201-330 of human PIK3CG (NP_002640.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
The antibody against PIK3CG was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 201-330 of human PIK3CG (NP_002640.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
| Cat.No | ADA-08518A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PIK3CG |
| Target Synonyms | PI3K; PIK3; IMD97; PI3CG; PI3Kgamma; p110gamma; p120-PI3K; PIK3CG | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 201-330 of human PIK3CG (NP_002640.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | WVTSKPLPEYLWKKIANNCIFIVIHRSTTSQTIKVSPDDTPGAILQSFFTKMAKKKSLMDIPESQSEQDFVLRVCGRDEYLVGETPIKNFQWVRHCLKNGEEIHVVLDTPPDPALDEVRKEEWPLVDDCT | Uniprot ID | P48736 |
Uniprot Id
P48736
Target Species
Human
Target Name
PIK3CG
Target Full Name
Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
Target Function
Phosphoinositide-3-kinase (PI3K) that phosphorylates PtdIns(4,5)P2 (Phosphatidylinositol 4,5-bisphosphate) to generate phosphatidylinositol 3,4,5-trisphosphate (PIP3). PIP3 plays a key role by recruiting PH domain-containing proteins to the membrane, including AKT1 and PDPK1, activating signaling cascades involved in cell growth, survival, proliferation, motility and morphology. Links G-protein coupled receptor activation to PIP3 production. Involved in immune, inflammatory and allergic responses. Modulates leukocyte chemotaxis to inflammatory sites and in response to chemoattractant agents. May control leukocyte polarization and migration by regulating the spatial accumulation of PIP3 and by regulating the organization of F-actin formation and integrin-based adhesion at the leading edge. Controls motility of dendritic cells. Together with PIK3CD is involved in natural killer (NK) cell development and migration towards the sites of inflammation. Participates in T-lymphocyte migration. Regulates T-lymphocyte proliferation and cytokine production. Together with PIK3CD participates in T-lymphocyte development. Required for B-lymphocyte development and signaling. Together with PIK3CD participates in neutrophil respiratory burst. Together with PIK3CD is involved in neutrophil chemotaxis and extravasation. Together with PIK3CB promotes platelet aggregation and thrombosis. Regulates alpha-IIb/beta-3 integrins (ITGA2B/ ITGB3) adhesive function in platelets downstream of P2Y12 through a lipid kinase activity-independent mechanism. May have also a lipid kinase activity-dependent function in platelet aggregation. Involved in endothelial progenitor cell migration. Negative regulator of cardiac contractility. Modulates cardiac contractility by anchoring protein kinase A (PKA) and PDE3B activation, reducing cAMP levels. Regulates cardiac contractility also by promoting beta-adrenergic receptor internalization by binding to GRK2 and by non-muscle tropomyosin phosphorylation. Also has serine/threonine protein kinase activity: both lipid and protein kinase activities are required for beta-adrenergic receptor endocytosis. May also have a scaffolding role in modulating cardiac contractility. Contributes to cardiac hypertrophy under pathological stress. Through simultaneous binding of PDE3B to RAPGEF3 and PIK3R6 is assembled in a signaling complex in which the PI3K gamma complex is activated by RAPGEF3 and which is involved in angiogenesis.
Target Subcellular Location
Cytoplasm. Cell membrane.
Target Protein Families
PI3/PI4-kinase family
Target Tissue Specificity
Pancreas, skeletal muscle, liver and heart.
Target Research Area
Cancer
Target Synonyms
1 phosphatidylinositol 3 kinase; 5-bisphosphate 3-kinase 110 kDa catalytic subunit gamma; 5-bisphosphate 3-kinase catalytic subunit gamma isoform; p110 gamma; p110gamma; p120 PI3K ; p120-PI3K; Phosphatidylinositol 3 kinase catalytic 110 kD gamma; Phosphatidylinositol 3 kinase gamma, p110 gamma; Phosphatidylinositol 3 kinase, catalytic, gamma polypeptide; Phosphatidylinositol 4 5 bisphosphate 3 kinase 110 kDa catalytic subunit gamma; Phosphatidylinositol 4 5 bisphosphate 3 kinase catalytic subunit gamma; Phosphatidylinositol 4 5 bisphosphate 3 kinase catalytic subunit gamma isoform; Phosphatidylinositol-4; Phosphoinositide 3 kinase catalytic gamma polypeptide; Phosphoinositide 3 kinase gamma catalytic subunit; PI 3 Kinase catalytic subunit gamma; PI3 kinase p110 subunit gamma; PI3-kinase subunit gamma; PI3CG; PI3K; PI3K-gamma; PI3Kgamma; PIK3; Pik3cg; PK3CG_HUMAN; PtdIns-3-kinase subunit gamma; PtdIns-3-kinase subunit p110-gamma; Serine/threonine protein kinase PIK3CG
Target Background
Phosphoinositide 3-kinases (PI3Ks) phosphorylate inositol lipids and are involved in the immune response. The protein encoded by this gene is a class I catalytic subunit of PI3K. Like other class I catalytic subunits (p110-alpha p110-beta, and p110-delta), the encoded protein binds a p85 regulatory subunit to form PI3K. This gene is located in a commonly deleted segment of chromosome 7 previously identified in myeloid leukemias. Several transcript variants encoding the same protein have been found for this gene.
Notification