Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PKLR was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 446-556 of human PKLR (NP_000289.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PKLR was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 446-556 of human PKLR (NP_000289.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09256A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PKLR |
| Target Synonyms | PK1; PKL; RPK; PKRL; PKLR | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 446-556 of human PKLR (NP_000289.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PLSRDPTEVTAIGAVEAAFKCCAAAIIVLTTTGRSAQLLSRYRPRAAVIAVTRSAQAARQVHLCRGVFPLLYREPPEAIWADDVDRRVQFGIESGKLRGFLRVGDLVIVVT | Uniprot ID | P30613 |
Uniprot Id
P30613
Target Species
Human
Target Name
PKLR
Target Full Name
Pyruvate kinase PKLR
Target Function
Plays a key role in glycolysis.
Target Involvement
Pyruvate kinase hyperactivity (PKHYP); Pyruvate kinase deficiency of red cells (PKRD)
Target Protein Families
Pyruvate kinase family
Target Research Area
Metabolism
Target Synonyms
EC 2.7.1.40; KPYR_HUMAN; L-PK; Pk-1; PK1 ; PKL ; Pklg; Pklr; PKR; PKRL; Pyruvate kinase 1; Pyruvate kinase isozymes R/L; Pyruvate kinase liver and blood cell; Pyruvate kinase liver and RBC; Pyruvate kinase liver and red blood cell; Pyruvate kinase liver type; Pyruvate kinase type L; Pyruvate kinase, red cell type; R type/L type pyruvate kinase; R-PK; R-type/L-type pyruvate kinase; Red cell/liver pyruvate kinase; RPK
Target Background
The protein encoded by this gene is a pyruvate kinase that catalyzes the transphosphorylation of phohsphoenolpyruvate into pyruvate and ATP, which is the rate-limiting step of glycolysis. Defects in this enzyme, due to gene mutations or genetic variations, are the common cause of chronic hereditary nonspherocytic hemolytic anemia (CNSHA or HNSHA). Multiple transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
