Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PLCB2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-199 of human PLCB2 (NP_004564.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PLCB2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-199 of human PLCB2 (NP_004564.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09136A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PLCB2 |
| Target Synonyms | PLC-beta-2; PLCB2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HEL, Rat lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-199 of human PLCB2 (NP_004564.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSLLNPVLLPPKVKAYLSQGERFIKWDDETTVASPVILRVDPKGYYLYWTYQSKEMEFLDITSIRDTRFGKFAKMPKSQKLRDVFNMDFPDNSFLLKTLTVVSGPDMVDLTFHNFVSYKENVGKAWAEDVLALVKHPLTANASRSTFLDKILVKLKMQLNSEGKIPVKNFFQMFPADRKRVEAALSACHLPKGKNDAIN | Uniprot ID | Q00722 |
Uniprot Id
Q00722
Target Species
Human
Target Name
PLCB2
Target Full Name
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2
Target Function
The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes.
Target Synonyms
PLC-beta-2; PLCB2
Target Background
The protein encoded by this gene is a phosphodiesterase that catalyzes the hydrolysis of phosphatidylinositol 4, 5-bisphosphate to the second messengers inositol 1, 4, 5-trisphosphate (IP3) and diacylglycerol. The encoded protein is activated by G proteins and has been shown to be involved in the type 2 taste receptor signal transduction pathway. In addition, nuclear factor kappa B can regulate the transcription of this gene, whose protein product is also an important regulator of platelet responses.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
