Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PLCL2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 130-300 of human PLCL2 (NP_055999.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PLCL2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 130-300 of human PLCL2 (NP_055999.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07002A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PLCL2 |
| Target Synonyms | PLCE2; PLCL2 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse skeletal muscle | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 130-300 of human PLCL2 (NP_055999.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TLDMLESSQDNMRTSWVSQMFSEIDVDNLGHITLCNAVQCIRNLNPGLKTSKIELKFKELHKSKDKAGTEVTKEEFIEVFHELCTRPEIYFLLVQFSSNKEFLDTKDLMMFLEAEQGVAHINEEISLEIIHKYEPSKEGQEKGWLSIDGFTNYLMSPDCYIFDPEHKKVCQ | Uniprot ID | Q9UPR0 |
Uniprot Id
Q9UPR0
Target Species
Human
Target Name
PLCL2
Target Full Name
Inactive phospholipase C-like protein 2
Target Function
May play an role in the regulation of Ins(1,4,5)P3 around the endoplasmic reticulum.
Target Subcellular Location
Cytoplasm.
Target Synonyms
FLJ13484; Inactive phospholipase C like protein 2; Inactive phospholipase C-like protein 2; KIAA1092; Phospholipase C epsilon 2; Phospholipase C L2; Phospholipase C like 2; Phospholipase C-epsilon-2; Phospholipase C-L2; PLC epsilon 2; PLC L(2); PLC L2; PLC-epsilon-2; PLC-L(2); PLC-L2; PLCE 2; PLCE2; PLCL 2; PLCL2; PLCL2_HUMAN
Target Background
Enables GABA receptor binding activity. Predicted to be involved in negative regulation of cold-induced thermogenesis and phosphatidylinositol-mediated signaling. Predicted to act upstream of or within several processes, including B cell activation; gamma-aminobutyric acid signaling pathway; and negative regulation of B cell receptor signaling pathway. Predicted to be located in cytoplasm.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
