-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against POC1B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 299-478 of human POC1B (NP_758440.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against POC1B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 299-478 of human POC1B (NP_758440.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02399A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | POC1B |
| Target Synonyms | PIX1; CORD20; TUWD12; WDR51B; POC1B | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, Jurkat | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 299-478 of human POC1B (NP_758440.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TNFDELHCKGLTKRNLKRLHFDSPPHLLDIYPRTPHPHEEKVETVEINPKLEVIDLQISTPPVMDILSFDSTTTTETSGRTLPDKGEEACGYFLNPSLMSPECLPTTTKKKTEDMSDLPCESQRSIPLAVTDALEHIMEQLNVLTQTVSILEQRLTLTEDKLKDCLENQQKLFSAVQQKS | Uniprot ID | Q8TC44 |
Uniprot Id
Q8TC44
Target Species
Human
Target Name
POC1B
Target Full Name
POC1 centriolar protein homolog B
Target Function
Plays an important role in centriole assembly and/or stability and ciliogenesis. Involved in early steps of centriole duplication, as well as in the later steps of centriole length control. Acts in concert with POC1A to ensure centriole integrity and proper mitotic spindle formation. Required for primary cilia formation, ciliary length and also cell proliferation. Required for retinal integrity.
Target Involvement
Cone-rod dystrophy 20 (CORD20)
Target Subcellular Location
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriole. Cytoplasm, cytoskeleton, cilium basal body. Cytoplasm, cytoskeleton, spindle pole.
Target Protein Families
WD repeat POC1 family
Target Tissue Specificity
Expressed in the retina.
Target Synonyms
4933430F16Rik; FLJ14923; FLJ41111; Pix1; POC1 centriolar protein homolog B (Chlamydomonas); POC1 centriolar protein homolog B; POC1B; POC1B_HUMAN; TUWD12; WD repeat containing protein 51B; WD repeat domain 51B; WD repeat-containing protein 51B; WDR51B
Target Background
POC1 proteins contain an N-terminal WD40 domain and a C-terminal coiled coil domain and are part of centrosomes. They play an important role in basal body and cilia formation. This gene encodes one of the two POC1 proteins found in humans. Mutation in this gene result in autosomal-recessive cone-rod dystrophy. Alternative splicing results in multiple transcript variants.
Notification