Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against POLR2K was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-58 of human POLR2K (NP_005025.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against POLR2K was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-58 of human POLR2K (NP_005025.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00906A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | POLR2K |
| Target Synonyms | RPB12; RPABC4; RPB7.0; hRPB7.0; hsRPB10a; RPB10alpha; ABC10-alpha; POLR2K | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HL-60, Mouse spleen, Rat spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-58 of human POLR2K (NP_005025.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR | Uniprot ID | P53803 |
Uniprot Id
P53803
Target Species
Human
Target Name
POLR2K
Target Full Name
DNA-directed RNA polymerases I, II, and III subunit RPABC4
Target Function
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and a small RNAs, such as 5S rRNA and tRNAs, respectively.
Target Subcellular Location
Nucleus.
Target Protein Families
Archaeal RpoP/eukaryotic RPC10 RNA polymerase subunit family
Target Synonyms
POLR2K; DNA-directed RNA polymerases I; II; and III subunit RPABC4; RNA polymerases I; II; and III subunit ABC4; ABC10-alpha; DNA-directed RNA polymerase II subunit K; RNA polymerase II 7.0 kDa subunit; RPB7.0; RPB10alpha
Target Background
This gene encodes one of the smallest subunits of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This subunit is shared by the other two DNA-directed RNA polymerases.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
